DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG34130

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:315 Identity:62/315 - (19%)
Similarity:108/315 - (34%) Gaps:96/315 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GCSYILFWFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAP 72
            |.::..:|   ..:|:.|......|.:|.:..:.....|.|...|...|   |...:||.:.::.
  Fly    18 GAAHSSWW---NSSASYLHGRPPVRTLNKNGIRRTSGGHAVPWLLRIVD---GPTFVCGASYLSA 76

  Fly    73 RKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRD---- 133
            ...||:|:|:::                       ||     ||:.|:: :...|.||.:|    
  Fly    77 LYALTSANCMHS-----------------------HR-----SQMESLS-VELVSSDSRQDNQLD 112

  Fly   134 -------------------------DVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQ 173
                                     ||.::.|...|..:....|.|...|:.       ..|...
  Fly   113 SHDPPNALIRNIIVSKDWHWPGTFMDVAVIELTNRLRGNRNNYVTLCTNPLS-------SYKSLS 170

  Fly   174 VAGWG-------RTEQSSLSNILLTANVSTIRHQTCRMIYRSGLL-PGMMCAGRLQGGTDSCQGD 230
            |..:|       |||:           :..:....|...|.:.|| ..:.||...:...| |...
  Fly   171 VVSYGAGPAENVRTEE-----------IEVLNRMICDSAYGNFLLRETVACAKEFKRSAD-CMFS 223

  Fly   231 SGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQW----IEGR-SGAPHSR 280
            :|.|:....:|.|:|:|...|....|||::.|:...:::    |.|: .|..|.:
  Fly   224 AGCPVTAGDQLCGIVAWSPACKRSNLPGIFTDIHQVKRFILKAISGKHKGTSHPK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 54/278 (19%)
Tryp_SPc 33..271 CDD:238113 53/278 (19%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 52/260 (20%)
Tryp_SPc 53..256 CDD:304450 51/253 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.