DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Gm5771

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Gm5771 / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:272 Identity:85/272 - (31%)
Similarity:128/272 - (47%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SYILFWFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSG-HICGGALIAPR 73
            |.:||..|:..|.|...::  .:|:.|...:.:...:.||:         .|| |.|||:||..:
Mouse     2 SALLFLALVGAAVAFPVDD--DKIVGGYTCRENSVPYQVSL---------NSGYHFCGGSLINDQ 55

  Fly    74 KVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRF-------EHRNGTIVSQVSSMAYMHTFSPDSM 131
            .|::||||.  ..|.:.|.....:.||....:|       :|.|               |:..::
Mouse    56 WVVSAAHCY--KTRIQVRLGEHNIKVLEGNEQFVNAAKIIKHPN---------------FNRKTL 103

  Fly   132 RDDVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQSSLS--NILLTANV 194
            .:|  |:.::...|::    ::..||.:.|.....|.|..|.::|||.|....:|  ::|...:.
Mouse   104 NND--IMLIKLSSPVT----LNARVATVALPSSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDA 162

  Fly   195 STIRHQTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGV 259
            ..:....|...|...:...|:|||.|:||.||||||||||:|..|.|.|:||||||||....|||
Mouse   163 PLLPQADCEASYPGKITGNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALADNPGV 227

  Fly   260 YVDVEYYRQWIE 271
            |..|..|..||:
Mouse   228 YTKVCNYVDWIQ 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 77/247 (31%)
Tryp_SPc 33..271 CDD:238113 78/247 (32%)
Gm5771NP_001034086.1 Tryp_SPc 22..238 CDD:214473 77/247 (31%)
Tryp_SPc 23..241 CDD:238113 79/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.