DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG7829

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster


Alignment Length:265 Identity:89/265 - (33%)
Similarity:131/265 - (49%) Gaps:25/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YILFWFLL---ACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAP 72
            |.|:|.||   |.....|:.....||:.|..|......::|||:|      :|..| |||::|..
  Fly     3 YKLWWKLLLLQASGCLSLESRPDPRIVGGFPADIANIPYIVSIQL------YGIHH-CGGSIINN 60

  Fly    73 RKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGI 137
            ..:|||.||| |....|..:     |.:|..:|: .::|.:.| |:.:.....|:|.:|..|:||
  Fly    61 HTILTAGHCL-NGVPHRLLK-----VKVGGTSRY-RKDGELFS-VADLQVHENFNPKTMDYDIGI 117

  Fly   138 LFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWG-RTEQSSLSNILLTANVSTIRHQT 201
            :.|...|.:|      ..|..|.:..:....|....:|||| ::.....|:.|..|.|..:....
  Fly   118 IRLTKNLTLS------RKVKAIPINPERVAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTA 176

  Fly   202 CRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYY 266
            ||.:....:...|:|||.|:||||:||.||||||....:|||:||||.|||....||||..::..
  Fly   177 CRNLLGKTVTDRMLCAGYLKGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDAL 241

  Fly   267 RQWIE 271
            ..|::
  Fly   242 HPWLD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 81/238 (34%)
Tryp_SPc 33..271 CDD:238113 81/238 (34%)
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 81/237 (34%)
Tryp_SPc 28..248 CDD:238113 81/240 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.