DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and intr

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:252 Identity:59/252 - (23%)
Similarity:87/252 - (34%) Gaps:101/252 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCL-----------YNNQRKRFRRASEFVV 98
            :|.| :|:| ::|..    ||.||||:.|.|||:|.|.           |..|..|.|..|...:
  Fly    99 KHFV-MRIL-YENKV----ICSGALISTRLVLTSALCFPRTLRQPPPRSYKLQASRSRIYSVANL 157

  Fly    99 VLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPMSPGGGVHLTVAPIQLAG 163
            :.|.:                             :|:.:|.|.               ||::  .
  Fly   158 ITGAI-----------------------------EDMALLLLH---------------APLE--D 176

  Fly   164 QITPPGKLCQVAGWGRTEQSSLSNILLTANVSTIRHQTCRMIYRSGLLPG--------------- 213
            ....|..||:            |.:....||:....|......|:.|:|.               
  Fly   177 PFVHPIDLCE------------SPLRRNDNVTMYMSQQHLRFLRTKLIPNSNCKRSYAQDENAFI 229

  Fly   214 ---MMCA---GRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPG-VYVDV 263
               |:||   .||.    .||...|..|:|:.||.||..:|..|::.|:.| :|.||
  Fly   230 TQTMLCALNSNRLV----DCQTAKGDVLLHQDRLCGVDIYGQHCSDGGVNGELYADV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 59/252 (23%)
Tryp_SPc 33..271 CDD:238113 59/252 (23%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 54/233 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.