DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG34129

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster


Alignment Length:290 Identity:70/290 - (24%)
Similarity:116/290 - (40%) Gaps:57/290 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GCSYILFWFLLACAA-ADLQENQQSRIINGSVAKADETRHLVS--------------IRLLRHDN 57
            |.|.|  |.|::|.. ..|.::|.:......:.|..:.|.:..              :|:|..|.
  Fly     2 GLSKI--WLLVSCLLWTCLPQSQGTVYPRDILLKTPKFRRVWGGVQSNTGPNFGGWLLRILNGDG 64

  Fly    58 NFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAY 122
            ||.    ||.|..||..|:|:|:|:|     .:|.:.|...|.||  .|...:....:.:.::.:
  Fly    65 NFA----CGAAYYAPLLVITSANCIY-----PYRNSLEGATVEGT--AFSECDRENYADIDTIQF 118

  Fly   123 MHTFSPDSMRDDVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVA----------GW 177
            ...|....:..||.::.||.               |::  |::|...:||.|.          ||
  Fly   119 PEKFIYQKLYMDVAVVRLRD---------------PVR--GRLTEFIRLCSVKVQPKMQMVVFGW 166

  Fly   178 G--RTEQSSLSNILLTANVSTIRHQTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGR 240
            |  .||....|:......|:.|..:.||..::|..:.......|.......|..|.|.||::...
  Fly   167 GFDNTEVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKNPKQCLYDGGSPLIYGRE 231

  Fly   241 LVGVVSWGYGCAEPGLPGVYVDVEYYRQWI 270
            |.||||:|..|.:...||:|.::...:::|
  Fly   232 LCGVVSFGSHCIDTSRPGMYTNIRRVKRFI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 61/263 (23%)
Tryp_SPc 33..271 CDD:238113 62/264 (23%)
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 59/249 (24%)
Tryp_SPc 55..261 CDD:304450 59/233 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.