DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG17475

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:294 Identity:92/294 - (31%)
Similarity:133/294 - (45%) Gaps:61/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLACAA---------ADLQENQ------------QSRIINGSVAKADETRHLVSIRLLRHDNNFG 60
            ||||..         |.|.|:|            |:|:|||...:..|.::.:|::     ..:|
  Fly    13 LLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQ-----GMYG 72

  Fly    61 SGHICGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSS-MAYMH 124
             ||||||.:|..|.|||||||:|.......|      |:.||:   |:.....|..|.. ..:.:
  Fly    73 -GHICGGCIIDERHVLTAAHCVYGYNPTYLR------VITGTV---EYEKPDAVYFVEEHWIHCN 127

  Fly   125 TFSPDSMRDDVGILFLRTGLPMS----PGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTE-QSS 184
            ..||| ..:|:.::.|...:..:    |   ..|..||:....|:.       :.|||.|| ...
  Fly   128 YNSPD-YHNDIALIRLNDTIKFNEYTQP---AELPTAPVANGTQLL-------LTGWGSTELWGD 181

  Fly   185 LSNILLTANVSTIRHQTCRMIYR----SGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVV 245
            ..:||..|.::.:.:.||:.|..    :|  |..:|. ...||..:|.|||||||.|.|.|.|:|
  Fly   182 TPDILQKAYLTHVVYSTCQEIMNNDPSNG--PCHICT-LTTGGQGACHGDSGGPLTHNGVLYGLV 243

  Fly   246 SWGYGCAEPGLPGVYVDVEYYRQWIEGRSGAPHS 279
            :|||.|| .|:|..:.:|.||.:||......|.|
  Fly   244 NWGYPCA-LGVPDSHANVYYYLEWIRSMISGPCS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 79/247 (32%)
Tryp_SPc 33..271 CDD:238113 79/247 (32%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 79/247 (32%)
Tryp_SPc 50..269 CDD:238113 80/248 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.