DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG17477

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:267 Identity:79/267 - (29%)
Similarity:126/267 - (47%) Gaps:35/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YILFWFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKV 75
            |||.:..|.|....|:.    .|:.|..|...:..:.||::.|     .|| |:||||:|:.|.:
  Fly     9 YILVFSSLYCDLLALEH----FIVGGQNAAEGDAPYQVSLQTL-----LGS-HLCGGAIISDRWI 63

  Fly    76 LTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMH-TFSPDSMRDDVGILF 139
            :||.||:......|.:      |..||:...|  .|.:  ......|:| .:.....::|:|:|.
  Fly    64 ITAGHCVKGYPTSRLQ------VATGTIRYAE--PGAV--YYPDAIYLHCNYDSPKYQNDIGLLH 118

  Fly   140 LRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQV-AGWG-RTEQSSLSNILLTANVSTIRHQTC 202
            |...:..:.     ||.| ::|.....|.|....| .||| ::...||.:.|.......:....|
  Fly   119 LNESITFNA-----LTQA-VELPTSPFPRGASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPAC 177

  Fly   203 RMIYRS----GLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDV 263
            ..:..:    .|.|..:||.| |....:|.|||||||||:|.|||::::...||: |:|.:::::
  Fly   178 ESMMSAYEDLELGPCHICAYR-QANIGACHGDSGGPLVHQGTLVGILNFFVPCAQ-GVPDIFMNI 240

  Fly   264 EYYRQWI 270
            .|||.|:
  Fly   241 MYYRDWM 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 72/244 (30%)
Tryp_SPc 33..271 CDD:238113 73/245 (30%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 73/245 (30%)
Tryp_SPc 27..246 CDD:214473 72/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.