DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG16749

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:272 Identity:81/272 - (29%)
Similarity:125/272 - (45%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHC 81
            ||..|.......|..|::||:.:..::...::|:|     .:.|| |.|||::|:.:.|:|||||
  Fly    14 LLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMR-----GSSGS-HSCGGSIISKQFVMTAAHC 72

  Fly    82 LYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSP-DSMRDDVGILFLRTGLP 145
            ...      |:||:..|..|...  .:..|..|.:|..:.....::| ::..:|:.:|.:..  |
  Fly    73 TDG------RKASDLSVQYGVTK--INATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEE--P 127

  Fly   146 MSPGGGVHLTVAPIQL-----AGQITPPGKLCQVAGWGRTE-----QSSLSNILL---TANVSTI 197
            ....|   :||||::|     |...|..|....:.|||...     ||:|..:.|   :....|.
  Fly   128 FEFDG---VTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTE 189

  Fly   198 RH--QTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGY-GCAEPGLPGV 259
            ||  :|....:        :|.|..:||...|.|||||||::.|:.||:|||.. .|.....|||
  Fly   190 RHGGRTDPRYH--------ICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGV 246

  Fly   260 YVDVEYYRQWIE 271
            |..|..|..||:
  Fly   247 YCKVSQYVDWIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 75/254 (30%)
Tryp_SPc 33..271 CDD:238113 75/254 (30%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 75/254 (30%)
Tryp_SPc 30..259 CDD:238113 76/256 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.