DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG12951

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:250 Identity:70/250 - (28%)
Similarity:110/250 - (44%) Gaps:28/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRASE 95
            ||::||:.:...:...:||:|      ::...|.|||::|:...|:|||||...      |.|..
  Fly    28 SRVVNGTDSSVLKYPFVVSLR------SYDGSHSCGGSIISKHFVMTAAHCTNG------RPADT 80

  Fly    96 FVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMR-DDVGILFLRTGLPMSPGGGVHLTVAPI 159
            ..:..|..|  ....|..|..:..:.....|.|.... :|:.:|.:..  |....|   ::|||:
  Fly    81 LSIQFGVTN--ISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEE--PFEFDG---VSVAPV 138

  Fly   160 QL-----AGQITPPGKLCQVAGWGRTE-QSSLSNILLTANVSTIRHQTCRMIYRSGLLPGM-MCA 217
            :|     |...:..|....:.|||..: ..|:.:.|...::.....:.|...:.....|.. :|.
  Fly   139 ELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICG 203

  Fly   218 GRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGY-GCAEPGLPGVYVDVEYYRQWIE 271
            |..:||...|.|||||||::.|:.||:|||.. .|.....||||..|..|..||:
  Fly   204 GVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 67/246 (27%)
Tryp_SPc 33..271 CDD:238113 67/246 (27%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 67/246 (27%)
Tryp_SPc 30..260 CDD:238113 68/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.