DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Try10

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001004097.1 Gene:Try10 / 408247 RGDID:1359400 Length:246 Species:Rattus norvegicus


Alignment Length:264 Identity:83/264 - (31%)
Similarity:122/264 - (46%) Gaps:47/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSG-HICGGALIAPRKVLTAAHC 81
            :|..|||     ..:|:.|...:.:...:.||:         .|| |.|||:||..:.|::||||
  Rat    14 VAFPAAD-----DDKIVGGYTCQENSVPYQVSL---------NSGYHFCGGSLINEQWVVSAAHC 64

  Fly    82 LYNNQRKRFRRASEFVVVLGTLNRF-------EHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILF 139
            .  ..|.:.|.....:.||....:|       :|.|               |...::.:|  |:.
  Rat    65 Y--KSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPN---------------FIRKTLNND--IML 110

  Fly   140 LRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQSSLS--NILLTANVSTIRHQTC 202
            ::...|:.    ::..||.:.|.....|.|..|.::|||.|....::  ::|...:...:....|
  Rat   111 IKLSSPVK----LNSRVATVALPSSCAPAGTQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADC 171

  Fly   203 RMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYR 267
            ...|...:...|:|||.|:||.||||||||||:|..|.|.|:||||||||.|..||||..|..|.
  Rat   172 EASYPGKITDNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYV 236

  Fly   268 QWIE 271
            .||:
  Rat   237 DWIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 77/247 (31%)
Tryp_SPc 33..271 CDD:238113 78/247 (32%)
Try10NP_001004097.1 Tryp_SPc 23..239 CDD:214473 77/247 (31%)
Tryp_SPc 24..242 CDD:238113 79/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.