DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Prss45

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001008864.1 Gene:Prss45 / 408244 RGDID:1303021 Length:330 Species:Rattus norvegicus


Alignment Length:299 Identity:81/299 - (27%)
Similarity:122/299 - (40%) Gaps:87/299 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ETRH----LVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLGTL 103
            |.||    .||:::   :|.    |:||||||....|::||||:..|:        |::|:||  
  Rat    56 EERHHWPWEVSLQI---ENE----HVCGGALIDQSWVVSAAHCIQGNK--------EYLVMLG-- 103

  Fly   104 NRFEHRNGTIVSQVSSMA--------YMHT--FSPDSMRDDVGILFLRTGLPMSPGGGVHLTVAP 158
                  :.|:....|..|        .||.  :..:.:|.|:.:|.|.|               |
  Rat   104 ------SSTLQPSGSPWALKIPVGDIIMHPKYWGQNFIRSDIALLCLET---------------P 147

  Fly   159 IQLAGQITP-----------PGKLCQVAGWGRTEQSSLSNI-----LLTANVSTIRHQTC-RMIY 206
            :.....|.|           .|..|.|.|||:.:|...:.:     |..|.||.:.::.| |:.:
  Rat   148 VTFNKYIQPICLPEHNFNLKVGMKCWVTGWGQAKQHPSAKLTRSLELWEAEVSIVDNKNCDRVFH 212

  Fly   207 RSGLLP--------GMMCAGRLQGGTDSCQGDSGGPLVHE--GR--LVGVVSWGYGCAEPGLPGV 259
            :....|        .|:|....:  .:.|.||.||||..|  ||  |.|:.||...|.:.....|
  Rat   213 KKTFYPQVIPLIRKNMICTTNHR--ENPCYGDPGGPLACEVHGRWILAGIFSWEKACTKAPNLSV 275

  Fly   260 YVDVEYYRQWIEGR--SGAPHSRLATGLFLLLLLPLLMR 296
            |..::.|..||:.:  .||...|..|.  .||.||.|::
  Rat   276 YTRIDKYTGWIKEQVSRGARSGRCRTS--CLLFLPWLLQ 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 70/269 (26%)
Tryp_SPc 33..271 CDD:238113 71/270 (26%)
Prss45NP_001008864.1 Tryp_SPc 57..289 CDD:238113 71/271 (26%)
Tryp_SPc 57..286 CDD:214473 69/268 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336780
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.