DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG11037

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:300 Identity:88/300 - (29%)
Similarity:128/300 - (42%) Gaps:63/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WFLLACAAA------DLQENQQSRII------NGSVAK----------------ADETR----HL 47
            |.|:.|..|      .:...:|.:|:      :|...|                ..|||    |:
  Fly     3 WHLVCCVLACTLVSTQVYGQEQEKIVLSLPDESGQPGKNLTLDVAQLAKIVLPSPHETRVIGGHV 67

  Fly    48 VS-------IRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNR 105
            .:       :..|.::::|    :|||.|:....|||||||.....     :|||::|..|..|.
  Fly    68 TTNAKLGGYLTALLYEDDF----VCGGTLLNENIVLTAAHCFLGRM-----KASEWIVAAGISNL 123

  Fly   106 FEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGK 170
              ::.| |...|........|..|.|..||.::.|:|.|...       .:..:.|......||.
  Fly   124 --NQKG-IRRHVKDFILSEQFREDDMNMDVAVVLLKTPLKAK-------NIGTLSLCSVSLKPGV 178

  Fly   171 LCQVAGWGRTEQSSLS--NILLTANVSTIRHQTCRMIYR--SGLLPGMMCAGRLQGGTDSCQGDS 231
            ...|:|||.|......  |:|.|..|..|..:.||..|:  :.:...|:||..| |..|:|..||
  Fly   179 ELVVSGWGMTAPRGRGPHNLLRTVTVPIIHKKNCRAAYQPTAKITDSMICAAVL-GRKDACTFDS 242

  Fly   232 GGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQWIE 271
            |||||.:.::.|:||:|.|||....||||.||.|.:.:||
  Fly   243 GGPLVFKKQVCGIVSFGIGCASNRYPGVYTDVMYVKPFIE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 81/274 (30%)
Tryp_SPc 33..271 CDD:238113 81/274 (30%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 76/239 (32%)
Tryp_SPc 62..283 CDD:238113 76/240 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.