DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Sems

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:283 Identity:96/283 - (33%)
Similarity:130/283 - (45%) Gaps:47/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILFWFLLACAAAD---LQENQ----------------QSRIINGSV-AKADETRHLVSIRLLRHD 56
            :||.||||....:   ||.|:                |:|:|.|.| ..|....:||:   :|:.
  Fly     4 LLFLFLLAGILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGYLVA---MRYF 65

  Fly    57 NNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMA 121
            |||    ||||.||....|||||||..:...|      |...|.|.::|...:.  |..||....
  Fly    66 NNF----ICGGTLIHELIVLTAAHCFEDRAEK------EAWSVDGGISRLSEKG--IRRQVKRFI 118

  Fly   122 YMHTFSPDSMRDDVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRT--EQSS 184
            ....|...:|..||.::.|..  ||     |...:..:.|......||:...|:|||.|  :...
  Fly   119 KSAQFKMVTMNMDVAVVLLNR--PM-----VGKNIGTLSLCSTALTPGQTMDVSGWGMTNPDDEG 176

  Fly   185 LSNILLTANVSTIRHQTCRMIYRS--GLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSW 247
            ..::|.|.:|..|..:.||..||.  .:...|.||..| |..|:|..|||||||:|.::.|:||:
  Fly   177 PGHMLRTVSVPVIEKRICREAYRESVSISDSMFCASVL-GKKDACTYDSGGPLVYEKQVCGIVSF 240

  Fly   248 GYGCAEPGLPGVYVDVEYYRQWI 270
            |.|||....||||.||.|.:.:|
  Fly   241 GIGCASRRYPGVYTDVHYVKPFI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 85/242 (35%)
Tryp_SPc 33..271 CDD:238113 85/243 (35%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 85/242 (35%)
Tryp_SPc 44..265 CDD:238113 85/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.