powered by:
Protein Alignment CG14780 and pik3ip1
DIOPT Version :9
Sequence 1: | NP_569920.2 |
Gene: | CG14780 / 31102 |
FlyBaseID: | FBgn0025383 |
Length: | 302 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_938188.1 |
Gene: | pik3ip1 / 386643 |
ZFINID: | ZDB-GENE-031030-14 |
Length: | 263 |
Species: | Danio rerio |
Alignment Length: | 50 |
Identity: | 10/50 - (20%) |
Similarity: | 20/50 - (40%) |
Gaps: | 5/50 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 190 LTANVSTIRHQTCRMIYRSGLL----PGMMCAGRLQ-GGTDSCQGDSGGP 234
:|..:|...:.||.::..:.:: |......:.. .|.|...|.:|.|
Zfish 212 ITLPLSAFANPTCELVDENTIVITAEPNNQTPTQEPVEGADPLMGSAGTP 261
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170575901 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.