DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and pik3ip1

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_938188.1 Gene:pik3ip1 / 386643 ZFINID:ZDB-GENE-031030-14 Length:263 Species:Danio rerio


Alignment Length:50 Identity:10/50 - (20%)
Similarity:20/50 - (40%) Gaps:5/50 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 LTANVSTIRHQTCRMIYRSGLL----PGMMCAGRLQ-GGTDSCQGDSGGP 234
            :|..:|...:.||.::..:.::    |......:.. .|.|...|.:|.|
Zfish   212 ITLPLSAFANPTCELVDENTIVITAEPNNQTPTQEPVEGADPLMGSAGTP 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 9/49 (18%)
Tryp_SPc 33..271 CDD:238113 9/49 (18%)
pik3ip1NP_938188.1 KR 24..101 CDD:214527
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..263 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575901
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.