DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG32277

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:263 Identity:83/263 - (31%)
Similarity:115/263 - (43%) Gaps:47/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRA 93
            :|.:|..|......:...||::|.       |....|||.:|:|..||||||||    ..|:::.
  Fly    23 RQGKIFGGKTTLVKDHSFLVNLRR-------GGKFRCGGVIISPNCVLTAAHCL----EGRYQQV 76

  Fly    94 SEFVV-----VLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRD---DVGILFLRTGLPMSPGG 150
            .:..|     .||.....||        |.|..|: ..||:....   |..:..:|...|....|
  Fly    77 RDLTVHAQQQCLGDDMPPEH--------VRSAWYV-GLSPNYCAQRGLDSDLAVIRLSRPFDIAG 132

  Fly   151 GVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQS--SLSNILLTANVSTIRHQTCRMIYRSG---L 210
            ...|    :::.....||.....|.|||...:.  :.:..|..|||..|.|:.|.....||   :
  Fly   133 NASL----VKIDYNDLPPHSNLTVLGWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKV 193

  Fly   211 LPGMMCA-GRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYV-----DVEYY-RQ 268
            ...|.|| |:  ...|:||||||||.::.||.||:|||||||.. |.||||.     .:.|: :.
  Fly   194 TNNMFCALGK--NARDACQGDSGGPAIYAGRSVGIVSWGYGCGS-GYPGVYTRLSSPSITYWLKD 255

  Fly   269 WIE 271
            :||
  Fly   256 FIE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 80/257 (31%)
Tryp_SPc 33..271 CDD:238113 80/257 (31%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 79/246 (32%)
Tryp_SPc 27..246 CDD:238113 79/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25869
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.