DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG32269

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:247 Identity:89/247 - (36%)
Similarity:123/247 - (49%) Gaps:35/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCL--YNNQRKRFRR 92
            ||||:.|:......|.::|.:|.       || ::|.|:||..:.|||||||:  |:        
  Fly   106 QSRIVGGTSTTISTTPYIVQLRR-------GS-NLCSGSLITEQWVLTAAHCVKGYS-------- 154

  Fly    93 ASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPMSPGGGVHLTVA 157
            ||:|.|..|| ...:..:| :...|||:.....|:...|..|..:|.|...|..:..|.:.:   
  Fly   155 ASDFTVRGGT-TTLDGSDG-VTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGTNIGTISM--- 214

  Fly   158 PIQLAGQITP-PGKLCQVAGWGRTEQSS--LSNILLTANVSTIRHQTCRMIYR--SGLLPGMMCA 217
                 |...| .|...::||||.|::.|  .|..|.||.:..:|.|.||..||  :.:...|:||
  Fly   215 -----GNYRPKAGSRVRIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCA 274

  Fly   218 GRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQW 269
              ...|.|||.||||||:.....|:|:||:|||||..|.||||..|...|||
  Fly   275 --RAAGKDSCSGDSGGPVTRNNTLLGIVSFGYGCARAGYPGVYTAVVAIRQW 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 87/245 (36%)
Tryp_SPc 33..271 CDD:238113 86/244 (35%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 85/243 (35%)
Tryp_SPc 121..324 CDD:238113 81/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.