DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG32833

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:225 Identity:54/225 - (24%)
Similarity:92/225 - (40%) Gaps:35/225 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPD 129
            |.||:.....::||..|:.....|..|      |.:|:..|   .:|.|...|.::.....|:..
  Fly    63 CDGAIYKLSHIVTAGKCVDGFLNKVIR------VRVGSTTR---SDGVIEVAVCNITVHEKFTGQ 118

  Fly   130 SMRDDVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQSSL--------- 185
            ::..:|.||.|...|..|.      |:.|||||.|:...|......||......::         
  Fly   119 TVFHNVAILKLCEPLEASK------TIQPIQLANQLPSNGAKVTANGWPSFRWWAMYWKKCLDDE 177

  Fly   186 SNILLTANVSTIRHQTCRMIY------RSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGV 244
            :..|..|.|..:....|..::      :......:.|..:.  ..::|....|.|:||.|:|||:
  Fly   178 AYKLQKAEVKLLGPSQCTDLWARNNWSKKNFTDDLFCTEKF--AKEACSLAMGSPVVHNGKLVGI 240

  Fly   245 VSWGYGCAEPGLPGVYVDVEYYRQWIEGRS 274
            ::.| ||:|  .|.||:::..|:.|:...:
  Fly   241 ITKG-GCSE--YPEVYINLIKYKDWLHNHT 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 53/219 (24%)
Tryp_SPc 33..271 CDD:238113 54/220 (25%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 54/222 (24%)
Tryp_SPc 40..262 CDD:214473 53/218 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.