DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Prss3

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001102096.1 Gene:Prss3 / 362347 RGDID:1311446 Length:246 Species:Rattus norvegicus


Alignment Length:270 Identity:83/270 - (30%)
Similarity:125/270 - (46%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILFWFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSG-HICGGALIAPRKV 75
            :||..|:..|.| ...:...:|:.|...:.:...:.||:         .|| |.|||:||..:.|
  Rat     4 LLFLALVGVAVA-FPVDDDDKIVGGYTCQENSVPYQVSL---------NSGYHFCGGSLINDQWV 58

  Fly    76 LTAAHCLYNNQRKRFRRASEFVVVLGTLNRF-------EHRNGTIVSQVSSMAYMHTFSPDSMRD 133
            ::||||.  ..|.:.|.....:.||....:|       :|.|               |:..::.:
  Rat    59 VSAAHCY--KTRIQVRLGEHNINVLEGDEQFVNAAKIIKHPN---------------FNARNLNN 106

  Fly   134 DVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQSSLSN--ILLTANVST 196
            |  |:.::...|:.    ::..||.:.|.....|.|..|.::|||.|....::|  :|...:...
  Rat   107 D--IMLIKLSSPVK----LNARVATVALPSSCAPAGTQCLISGWGNTLSLGVNNPDLLQCLDAPV 165

  Fly   197 IRHQTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYV 261
            :....|...|...:...|:|.|.|:||.||||||||||:|..|:|.|:||||||||....||||.
  Rat   166 LPQADCEASYPGKITNNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYT 230

  Fly   262 DVEYYRQWIE 271
            .|..|..||:
  Rat   231 KVCNYVDWIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 76/247 (31%)
Tryp_SPc 33..271 CDD:238113 77/247 (31%)
Prss3NP_001102096.1 Tryp_SPc 23..239 CDD:214473 76/247 (31%)
Tryp_SPc 24..242 CDD:238113 78/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.