DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and etaTry

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:257 Identity:89/257 - (34%)
Similarity:138/257 - (53%) Gaps:17/257 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAH 80
            |||...|...|.:  .||:.|:...:..|:::|.:| .|..::......|||.::....:.||||
  Fly    13 FLLGIYAVSAQSD--GRIVGGADTSSYYTKYVVQLR-RRSSSSSSYAQTCGGCILDAVTIATAAH 74

  Fly    81 CLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLP 145
            |:||      |.|..|:||.|..:| ...||.:| :||.:.....::..:|.:|:.::.:...||
  Fly    75 CVYN------REAENFLVVAGDDSR-GGMNGVVV-RVSKLIPHELYNSSTMDNDIALVVVDPPLP 131

  Fly   146 MSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQSSL-SNILLTANVSTIRHQTCR-MIYRS 208
            :..    ..|:..|::|.:....|....::|||.|:::.| |:.|....|..:..:.|: ..|..
  Fly   132 LDS----FSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEAYYWR 192

  Fly   209 GLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQWI 270
            .:..||:|||..:||.|:||||||||||...:|.|:||||.|||.|..||||.:|.||:.||
  Fly   193 PISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 82/239 (34%)
Tryp_SPc 33..271 CDD:238113 83/240 (35%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 82/239 (34%)
Tryp_SPc 28..257 CDD:238113 83/240 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.