DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Send2

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:261 Identity:81/261 - (31%)
Similarity:117/261 - (44%) Gaps:47/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FLLACAAADLQE----NQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVL 76
            |||..|...|..    ..:.|||.|.....:|....|||   :.|..    |:|||::.:...::
  Fly     6 FLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSI---QRDGK----HLCGGSIYSADIII 63

  Fly    77 TAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLR 141
            |||||: ..|..:.|..|          ..::.||::|    .:|.:.|.  :.:.:|:.|:.|.
  Fly    64 TAAHCV-QGQGYQVRAGS----------ALKNSNGSVV----DVAAIRTH--EGLGNDIAIVRLS 111

  Fly   142 TGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQSSLSNILLTANVSTIRHQTCRMIY 206
            ..|..:.      .|.||.||....|||.:..|:|||.:...|....|...|:      ..:..|
  Fly   112 KPLEFTN------QVQPIPLAKTNPPPGSIAFVSGWGSSSYYSHPIDLQGVNL------YIQWPY 164

  Fly   207 RSGLL-PGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWG-YGCAEPGLPGVYVDVEYYRQW 269
            ..||. |..:|||..  |..:|:||||||||.:.:||||||.| ..|.   ...:|..|.|:|:|
  Fly   165 YCGLTEPSRICAGSF--GRAACKGDSGGPLVFDQQLVGVVSGGTKDCT---YSSIYTSVPYFREW 224

  Fly   270 I 270
            |
  Fly   225 I 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 74/239 (31%)
Tryp_SPc 33..271 CDD:238113 75/240 (31%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 74/239 (31%)
Tryp_SPc 27..225 CDD:238113 73/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.