DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Try29F

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:299 Identity:92/299 - (30%)
Similarity:125/299 - (41%) Gaps:60/299 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TQFGLHG-CSYILFWFL-------LACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNN 58
            :..||.| ...||..|:       |:..|...:.....||:.|.||...:..:.||::       
  Fly     3 SSIGLTGMAKTILHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQ------- 60

  Fly    59 FGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYM 123
             .|.|.|||:|||...|||||||            :|...:|.:..|......::..|:..:..:
  Fly    61 -RSYHFCGGSLIAQGWVLTAAHC------------TEGSAILLSKVRIGSSRTSVGGQLVGIKRV 112

  Fly   124 H---TFSPDSMRDDVGILFLR-----------TGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQV 174
            |   .|...::..|..:|.|.           .|||.....               ...|....|
  Fly   113 HRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDAD---------------IADGTPVLV 162

  Fly   175 AGWGRTEQS-SLSNILLTANVSTIRHQTCRMIYRS--GLLPGMMCAGRLQGGTDSCQGDSGGPLV 236
            :|||.|:.: ..|.:|.:..|..:....|...|.:  .:...|:|||..:||.|:|||||||||.
  Fly   163 SGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLA 227

  Fly   237 HEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQWIEGRSG 275
            .:|.|.||||||||||.|..||||..|...|.||...||
  Fly   228 ADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISSVSG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 80/254 (31%)
Tryp_SPc 33..271 CDD:238113 80/254 (31%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 80/254 (31%)
Tryp_SPc 42..264 CDD:238113 81/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.