DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and PRSS53

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:288 Identity:70/288 - (24%)
Similarity:102/288 - (35%) Gaps:106/288 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 HICGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFS 127
            |||.|:|:|...|||||||.   ::......:.:.||||:|.|                  ...|
Human    60 HICSGSLVADTWVLTAAHCF---EKAAATELNSWSVVLGSLQR------------------EGLS 103

  Fly   128 PDSMRDDVGILFLRTGLP-----MSPGGGVHLTVAPIQLAGQIT-------------PPGKLCQV 174
            |.:  ::||:..|:  ||     .|.|..:.|    :|||...|             |.|..|..
Human   104 PGA--EEVGVAALQ--LPRAYNHYSQGSDLAL----LQLAHPTTHTPLCLPQPAHRFPFGASCWA 160

  Fly   175 AGWGRT-------------EQSSLSNILLTA---------------------------------N 193
            .||.:.             |...|.::.::|                                 .
Human   161 TGWDQDTSDGKCWPRLKLGEALCLPSVTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLR 225

  Fly   194 VSTIRHQTCRMIYR--------SGLLPGMMCAGRLQGGTDSCQGDSGGP---LVHEGRLV--GVV 245
            :..|...||..||.        :...|||:|.|...|....||||||||   |..:|..|  |::
Human   226 LRLISRPTCNCIYNQLHQRHLSNPARPGMLCGGPQPGVQGPCQGDSGGPVLCLEPDGHWVQAGII 290

  Fly   246 SWGYGCAEPGLPGVYVDVEYYRQWIEGR 273
            |:...||:...|.:..:...:..|::.|
Human   291 SFASSCAQEDAPVLLTNTAAHSSWLQAR 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 68/283 (24%)
Tryp_SPc 33..271 CDD:238113 69/284 (24%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 69/284 (24%)
Tryp_SPc 43..314 CDD:214473 68/282 (24%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.