DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG4271

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:274 Identity:81/274 - (29%)
Similarity:117/274 - (42%) Gaps:65/274 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSG-HICGGALIAPRKVLTA 78
            |.|:..|      ...:.|.||..||.|....|.|:        :.|| |.||||:|..|.||||
  Fly     7 WVLILFA------RSSNGIYNGVEAKFDFWTFLASV--------WVSGYHECGGAVIDSRIVLTA 57

  Fly    79 AHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTG 143
            |.|:.|...||      ..|.:||.:.:  |.|.|: :|:::.....:.  :..:|:.:|:|.  
  Fly    58 AQCVKNKPVKR------ITVRVGTPDIY--RGGRII-RVTALVVHENYK--NWDNDIALLWLE-- 109

  Fly   144 LPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQSSLSNILLTA----NVSTIRHQTCRM 204
               .|...|.:|..|  ||.:.....:....||||   :..|.:.::|.    .|:.||      
  Fly   110 ---KPVLSVRVTKIP--LATKEPSENEYPSNAGWG---EKLLESYVVTRKLQNGVTKIR------ 160

  Fly   205 IYRSGLLPGMMCAGRL------------QGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLP 257
                   |..|||..|            ....|.|.||.|||||...::||:...|:||....||
  Fly   161 -------PRSMCAEELVEPVGEELLCAFYTENDICPGDYGGPLVLANKVVGIAVQGHGCGFAVLP 218

  Fly   258 GVYVDVEYYRQWIE 271
            .:|.:|.:|.:|||
  Fly   219 SLYTNVFHYLEWIE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 75/254 (30%)
Tryp_SPc 33..271 CDD:238113 76/254 (30%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 78/256 (30%)
Tryp_SPc 19..231 CDD:214473 75/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25869
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.