DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Send1

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster


Alignment Length:247 Identity:73/247 - (29%)
Similarity:103/247 - (41%) Gaps:44/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRASEF 96
            |||.||.....:....||::.      :|. |.|||::.:...::|||||:...:|. .|..|..
  Fly    29 RIIGGSSMDITDVPWQVSLQY------YGE-HFCGGSIYSKTIIITAAHCIKEGERS-IRAGSSL 85

  Fly    97 VVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPMSPGGGVHLTVAPIQL 161
                       |.:|.:|..|.:......|...:|.:||.:|.|.:.|..|.      ::..|.|
  Fly    86 -----------HDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSD------SIQTIPL 133

  Fly   162 AGQITPPGKLCQVAGWG------RTEQSSLSNILLTANVSTIRHQTCRMIYRSGLLPGMMCAGRL 220
            |....|........|||      |..|.....||:...:      .|::.|.:|:....:||||:
  Fly   134 AETDPPTSSSALATGWGRGNFLIRPRQLQGVEILIRPLI------VCKLKYGNGVFNEDICAGRM 192

  Fly   221 QGGTDSCQGDSGGPLVHEGRLVGVVS--WGYGCAEPGLPGVYVDVEYYRQWI 270
              |...|.||||||||..|:|||:.|  ....|....|   |..|..||.||
  Fly   193 --GKGGCYGDSGGPLVFNGQLVGITSRTGNIVCLGSSL---YASVARYRNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 71/245 (29%)
Tryp_SPc 33..271 CDD:238113 72/246 (29%)
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 71/245 (29%)
Tryp_SPc 30..239 CDD:238113 70/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.