DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG11911

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:253 Identity:68/253 - (26%)
Similarity:104/253 - (41%) Gaps:38/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IINGSVAKADETRHLVSI--RLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRASE 95
            :|||:.|:.....::||:  ..|:|      .|||||.||....::|||||:           ||
  Fly    37 VINGTEAEPHSAPYIVSLATNYLKH------SHICGGTLINKDWIVTAAHCI-----------SE 84

  Fly    96 FV---VVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPMSPGGGVHLTVA 157
            .|   ::.|...|.|....|...||........::......|:.:|.:......:.      .|.
  Fly    85 PVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNE------WVQ 143

  Fly   158 PIQLAGQITPPGKLCQVAGWGRTEQSSLS--NILLTANVSTIRHQTCR--MIYRSGLLPGMMCAG 218
            |..|..:.........:.|||:.:....|  ..|.|.....:.::.|:  :...:.:....:|:.
  Fly   144 PATLPSREQVHEGETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSS 208

  Fly   219 RLQGGTDSCQGDSGGPLVHE-----GRLVGVVSWGY-GCAEPGLPGVYVDVEYYRQWI 270
            .||....:|.||||||||.|     ..|:|:||||| .|....:|.:|..|..|..||
  Fly   209 SLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 66/251 (26%)
Tryp_SPc 33..271 CDD:238113 68/253 (27%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 68/253 (27%)
Tryp_SPc 37..266 CDD:214473 66/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.