DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG1304

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:265 Identity:75/265 - (28%)
Similarity:120/265 - (45%) Gaps:24/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FWFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTA 78
            |..|||........:...|::.|..|..::..|.||:|      |.|| |.|||::::...||||
  Fly    13 FLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLR------NAGS-HSCGGSILSRNYVLTA 70

  Fly    79 AHCLYN---NQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFL 140
            |||:.|   |.......|..|.:..|:.:||   :|.::.||:.:.....:.  :..:||.:|.|
  Fly    71 AHCVTNQDSNGNSVPIAAERFTIRAGSNDRF---SGGVLVQVAEVIVHEEYG--NFLNDVALLRL 130

  Fly   141 RTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTE-QSSLSNILLTANVSTIRHQTCRM 204
            .:.|.:|      .::.||.|....||......::||||.: |..|...|....:.:|..:.|..
  Fly   131 ESPLILS------ASIQPIDLPTADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDE 189

  Fly   205 IYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQW 269
            :...|:...:........|  :|.||||||.|:..::|||..:.:.......|..|..|.|:.:|
  Fly   190 LIGWGVQSELCLIHEADNG--ACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEW 252

  Fly   270 IEGRS 274
            |:..|
  Fly   253 IKNNS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 68/241 (28%)
Tryp_SPc 33..271 CDD:238113 68/241 (28%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 68/241 (28%)
Tryp_SPc 32..256 CDD:238113 69/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.