DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG9672

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster


Alignment Length:264 Identity:69/264 - (26%)
Similarity:120/264 - (45%) Gaps:33/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHC 81
            |:..||..|:...|.||..|..|...:..:..::       :.|..:.||..:|..|..|||..|
  Fly     9 LILVAAGVLEAQPQGRIAGGEDAVLGQLPYQAAL-------SIGGSYNCGAVIIGQRYALTALSC 66

  Fly    82 LYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPD--SMRDDVGILFLRTGL 144
            :.::.:.....|..|.|.:|:::.:   ||..: :|..:    |.:|:  :::..:.:|.|:..:
  Fly    67 VCSDGKDTPWAAVLFAVTVGSVDLY---NGKQI-RVEEI----TINPNYSTLKTGIALLRLQEEI 123

  Fly   145 PMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQS--SLSNILLTANVSTIRHQTCRMIYR 207
            ..|.      ||..|.|:..:.|.|...:|:|||||.:|  ::...|.......:..:.|.:..|
  Fly   124 TFSE------TVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANR 182

  Fly   208 SGLLPG---MMCA--GRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYR 267
            ..||..   ::|.  ||.||   .|.||.|||.|::|:|||:.:...|.....||..::.:....
  Fly   183 DELLVADDQVLCLGHGRRQG---ICSGDIGGPAVYQGQLVGLGAQILGECGGMLPERFISIAANY 244

  Fly   268 QWIE 271
            .||:
  Fly   245 DWIQ 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 62/246 (25%)
Tryp_SPc 33..271 CDD:238113 62/246 (25%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 62/246 (25%)
Tryp_SPc 25..250 CDD:238113 63/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25869
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.