DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG4653

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:266 Identity:70/266 - (26%)
Similarity:118/266 - (44%) Gaps:27/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SYILFWFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRK 74
            ||.....||......|...|.||:    .|:.....|.:|:|.       ...|:||||||..:.
  Fly     6 SYSHSRLLLLVVIVTLGVVQSSRL----PAEVGSQPHSISLRR-------NGVHVCGGALIREKW 59

  Fly    75 VLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSM-RDDVGIL 138
            :||||||:.....::...|..:.|.:|::.|.  ..|.:|.....:.:.:..|.|:: .:|:.:|
  Fly    60 ILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRL--TGGQLVPLSKIIIHTNYSSSDAVGSNDLALL 122

  Fly   139 FLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTE-QSSLSNILLTANVSTIRHQTC 202
            .|.|.:.:      :....||.||.:....|.....:|||.:: ..|||::|..|...::....|
  Fly   123 ELETSVVL------NANTNPIDLATERPAAGSQIIFSGWGSSQVDGSLSHVLQVATRQSLSASDC 181

  Fly   203 RM-IYRSGLLPGMMCAGRL-QGGTDSCQGDSGGPLVHEGRLVGVVSWGY-GCAEPGLPGVYVDVE 264
            :. :|..  ...::|...: :.....|.||:|.|..:..:|||:.::.. ||... .|..||||.
  Fly   182 QTELYLQ--QEDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSE-QPDGYVDVT 243

  Fly   265 YYRQWI 270
            .:.:||
  Fly   244 QHLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 61/242 (25%)
Tryp_SPc 33..271 CDD:238113 62/243 (26%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 62/238 (26%)
Tryp_SPc 30..249 CDD:214473 60/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25869
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.