DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG9673

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:284 Identity:74/284 - (26%)
Similarity:119/284 - (41%) Gaps:49/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GCSYILFWFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAP 72
            |...::|..:|:..|     :.|.||:.|......|.....|:|       :...|:|.||:|:.
  Fly     9 GLGLLIFGLILSAEA-----SPQGRILGGEDVAQGEYPWSASVR-------YNKAHVCSGAIIST 61

  Fly    73 RKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGI 137
            ..:||||||: ::.......||...|.|||:|  ::..|:||:..|.:.:.   |..:...|:.|
  Fly    62 NHILTAAHCV-SSVGITPVDASTLAVRLGTIN--QYAGGSIVNVKSVIIHP---SYGNFLHDIAI 120

  Fly   138 LFLRTGLPMSPGGGVHLTVAPIQLAGQITPP---------------GKLCQVAGWGRTEQSSLSN 187
            |.|...|..|.      .:..|.|     ||               |....|||||.....:.|.
  Fly   121 LELDETLVFSD------RIQDIAL-----PPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASY 174

  Fly   188 ILLTANVSTIRHQTCRMIYRSGL-LPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLV-GVVSWGYG 250
            ....||.:|:....|.  :.:|. ...::|..|.: |...|:||:|..::.:.::: |:.|:.:|
  Fly   175 KQQKANYNTLSRSLCE--WEAGYGYESVVCLSRAE-GEGICRGDAGAAVIDDDKVLRGLTSFNFG 236

  Fly   251 CAEPGLPGVYVDVEYYRQWIEGRS 274
            ......|.|...|.||..|||..:
  Fly   237 PCGSKYPDVATRVSYYLTWIEANT 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 66/254 (26%)
Tryp_SPc 33..271 CDD:238113 66/254 (26%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 66/254 (26%)
Tryp_SPc 29..259 CDD:238113 68/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25869
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.