DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and sphe

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:245 Identity:70/245 - (28%)
Similarity:117/245 - (47%) Gaps:25/245 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRAS 94
            |.||:.|..|.|..|....|:|:   ||    .|:|||::::..|:||.|||::.:  .:...||
  Fly    23 QGRIMGGEDADATATTFTASLRV---DN----AHVCGGSILSQTKILTTAHCVHRD--GKLIDAS 78

  Fly    95 EFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPD--SMRDDVGILFLRTGLPMSPGGGVHLTVA 157
            .....:|:.|  ::..|.||: |.|:| :|   ||  ::.:::.::.|.:.|..:.    .:|..
  Fly    79 RLACRVGSTN--QYAGGKIVN-VESVA-VH---PDYYNLNNNLAVITLSSELTYTD----RITAI 132

  Fly   158 PIQLAGQITP-PGKLCQVAGWGRTEQSSLSNILLTANVSTIRHQTCRMIYRSGLLPGMMCAGRLQ 221
            |:..:|:..| .|....|||||||...:.|..:...::......||...|..........|..|:
  Fly   133 PLVASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSDHDEQSFCLAHELK 197

  Fly   222 GGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQWIE 271
            .||  |.||.||..::...|:|:.::..|......|.|:|.:..|..||:
  Fly   198 EGT--CHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 67/240 (28%)
Tryp_SPc 33..271 CDD:238113 67/240 (28%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 63/226 (28%)
Tryp_SPc 42..244 CDD:214473 61/223 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.