DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG31681

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:266 Identity:84/266 - (31%)
Similarity:128/266 - (48%) Gaps:43/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCL 82
            |||||.  ....:.||:.||....:.....||::     ||  |.|.|||.:.:.|.:|||||||
  Fly    16 LACAAR--IPGPEERIVGGSYIPIEYVPWQVSVQ-----NN--SLHCCGGVIYSDRAILTAAHCL 71

  Fly    83 YNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAY----MHTFSPDSMRDDVGILFLRTG 143
            .|      ...::..|..|  :.:..:.|.::..:.::|:    ...::|    .|:.:|.|.. 
  Fly    72 SN------VTVTDLSVRAG--SSYWSKGGQVLKVLKTIAHPKYVPKLYNP----YDIAVLILEA- 123

  Fly   144 LPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQSS--LSNILLTANVSTIRHQTCRMIY 206
             |:..||    ||..|.||.|....|.:...:|||.|.::|  |..||...:|:.:....|...|
  Fly   124 -PLRLGG----TVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAY 183

  Fly   207 RS-GLLPGMMCAGRLQGGTDSCQGDSGGPLVH-----EGRLVGVVSWGYGCAEPGLPGVYVDVEY 265
            :. .:...|:||...:  .|:|||||||||:.     ..:|:|:||||.||...  ||||.|:.:
  Fly   184 KHVNITIDMICADGQR--WDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTN--PGVYEDIAF 244

  Fly   266 YRQWIE 271
            :..||:
  Fly   245 FHNWIK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 77/249 (31%)
Tryp_SPc 33..271 CDD:238113 77/249 (31%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 77/249 (31%)
Tryp_SPc 29..250 CDD:238113 77/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.