DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG32808

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:298 Identity:93/298 - (31%)
Similarity:136/298 - (45%) Gaps:56/298 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LFW---FLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSG-HICGGALIAPR 73
            ||:   ||||.|:     .:..:|:||:.|...|...:||:|..:      || |.||..|:.|.
  Fly    12 LFYTATFLLAGAS-----GEDGKIVNGTTAGPGEFPFVVSLRRAK------SGRHSCGATLLNPY 65

  Fly    74 KVLTAAHCLYNNQRKR--FRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSP-DSMRDDV 135
            .|||||||:..:..::  .:..|:.:.          ||.:.|::|:::.....:.| |...:|:
  Fly    66 WVLTAAHCVRGSSPEQLDLQYGSQMLA----------RNSSQVARVAAIFVHPGYEPEDKYVNDI 120

  Fly   136 GILFLRTGLPMSPGGGVHLTVAPIQL--AGQITPPGKLCQVAGWGRTE-----QSSLSNILLTAN 193
            .:|.|...:.:|.      .|.|::|  ..|:||......:||||...     |..|..:.|...
  Fly   121 ALLQLAQSVALSK------FVQPVRLPEPRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVF 179

  Fly   194 VST---IRHQTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEG--RLVGVVSWGY-GCA 252
            ..|   .||||.       |....:|||..:||...|.|||||||:..|  ..||:|||.. .||
  Fly   180 SDTECSERHQTY-------LHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCA 237

  Fly   253 EPGLPGVYVDVEYYRQWI--EGRSGAPHSRLATGLFLL 288
            .|..|||:.:|..|..||  ...|.:|.|.|..|..::
  Fly   238 RPPFPGVFTEVSAYVDWIVETVNSYSPPSSLWVGQLIV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 79/254 (31%)
Tryp_SPc 33..271 CDD:238113 81/256 (32%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 79/254 (31%)
Tryp_SPc 30..258 CDD:238113 81/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.