DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG32755

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:251 Identity:95/251 - (37%)
Similarity:137/251 - (54%) Gaps:28/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RIINGSVAKADETRHLVSIRLLR-HDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKR--FRRA 93
            :|:.|.....|:....||:|... |:.::|.||:||||:|:.|.|.:||||...|....  :|..
  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101

  Fly    94 SEFVVVLGT-----LNRF--EHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPM-SPGG 150
            ..:|||.|:     .:||  |:....||..       ..::..::.:|:.:|||...:|. ||| 
  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGH-------KDYNGSTLENDIALLFLNGFIPWESPG- 158

  Fly   151 GVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQSSLSNILLTANVSTIRHQTCRMIYRSGLLP-GM 214
                 |..|.||.:....|..|.:.|||:......|..|..|.|..:..:.|::||:   || ..
  Fly   159 -----VRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQAPVPILNKELCQVIYK---LPASQ 215

  Fly   215 MCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQWI 270
            ||||.||||.|:|||||||||:.:|||.|::|||.|||:||.||||.:|.::.:||
  Fly   216 MCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 93/249 (37%)
Tryp_SPc 33..271 CDD:238113 95/250 (38%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 93/249 (37%)
Tryp_SPc 38..273 CDD:238113 95/250 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0012686
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.