DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG32523

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:290 Identity:78/290 - (26%)
Similarity:121/290 - (41%) Gaps:70/290 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLACA-----AADLQENQ-----QSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIA 71
            ||.|.     ..|:.:||     :.||:.|..||..:..|.:|:||       ...|.|||.:|:
  Fly    11 LLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRL-------RGEHYCGGVIIS 68

  Fly    72 PRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQV-SSMAYMHTFSPDSMR--- 132
            ...|:||.||:                        :|.|..:.:.: |..|.....|.|.:|   
  Fly    69 ATHVITAGHCV------------------------KHGNDVVPADLWSIQAGSLLLSSDGVRIPV 109

  Fly   133 --------------DDVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGR-TEQ 182
                          :|:.:|.|::.|...      ..:|.||||.:..|......::|||. .|:
  Fly   110 AEVIMHPNYATGGHNDLAVLRLQSPLTFD------ANIAAIQLATEDPPNCVAVDISGWGNIAEK 168

  Fly   183 SSLSNILLTANVSTIRHQTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVS- 246
            ..||:.||...|::|....||.::.|.|...|:|....: .:.:|.||||||..:.|::||:.| 
  Fly   169 GPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSK-NSGACYGDSGGPATYGGKVVGLASL 232

  Fly   247 -WGYGCAEPGLPGVYVDVEYYRQWIEGRSG 275
             .|.||.. ..|..|:.:...|.||..::|
  Fly   233 LLGGGCGR-AAPDGYLRISKVRAWIAEKAG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 69/258 (27%)
Tryp_SPc 33..271 CDD:238113 69/258 (27%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 69/258 (27%)
Tryp_SPc 37..219 CDD:238113 56/219 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.