DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG32376

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:257 Identity:78/257 - (30%)
Similarity:121/257 - (47%) Gaps:33/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQ 86
            |.:.||:..:||:||......|.....|   |.::..|    :||..:|....:|||.||.:...
  Fly    55 ALEAQESFPTRIVNGKRIPCTEAPFQGS---LHYEGYF----VCGCVIINKIWILTAHHCFFGPP 112

  Fly    87 RKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPMSPGGG 151
            .|       :.|.:|:   .:.|.|..:..|..:..:..::..:||.|:.::.|::  |:..|  
  Fly   113 EK-------YTVRVGS---DQQRRGGQLRHVKKIVALAAYNDYTMRHDLAMMKLKS--PVYFG-- 163

  Fly   152 VHLTVAPIQLAGQITP--PGKLCQVAGWGRTEQS--SLSNILLTANVSTIRHQTCRMIYRSG--- 209
              ..|.|::|....|.  |.|.. |:|||.|..:  ::...|....:..|:...|:.:|:..   
  Fly   164 --KCVRPVKLPSTKTTKFPKKFV-VSGWGITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLK 225

  Fly   210 LLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQWIE 271
            :...|:||.|.  ..|||.|||||||...|.|.|:||||.|||....|||||:.:.|..||:
  Fly   226 IYKDMICASRT--NKDSCSGDSGGPLTSRGVLYGIVSWGIGCANKNYPGVYVNCKRYVPWIK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 73/244 (30%)
Tryp_SPc 33..271 CDD:238113 73/244 (30%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 73/244 (30%)
Tryp_SPc 66..287 CDD:238113 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.