DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Prtn3

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:261 Identity:80/261 - (30%)
Similarity:112/261 - (42%) Gaps:44/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRA 93
            |.|:|:.|..|:.....::.|::|.|...:    |.|||.||.||.||||||||.:...:.    
  Rat   194 QASKIVGGHEARPHSRPYVASLQLSRSPGS----HFCGGTLIHPRFVLTAAHCLQDISWQL---- 250

  Fly    94 SEFVVVLGT---LNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPMSPGGGVHLT 155
              ..||||.   |:....:....::||    :.:.::|:...:||  |.|:...|.|.|..|  .
  Rat   251 --VTVVLGAHDLLSSEPEQQKFTITQV----FENNYNPEETLNDV--LLLQLNRPASLGKQV--A 305

  Fly   156 VAPIQLAGQITPPGKLCQVAGWGRT-EQSSLSNILLTANVSTI-----RHQTCRMIYRSGLLPGM 214
            ||.:....|....|..|...||||. .::....:|...||:.:     .|..|.::.|       
  Rat   306 VASLPQQDQSLSQGTQCLAMGWGRLGTRAPTPRVLHELNVTVVTFLCREHNVCTLVPR------- 363

  Fly   215 MCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGY-GCAEPGLPGVYVDVEYYRQWIEG--RSGA 276
                |..|   .|.|||||||:..|.|.||.|:.. .||....|..:..|..|..||..  ||..
  Rat   364 ----RAAG---ICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVNWIHSVLRSAE 421

  Fly   277 P 277
            |
  Rat   422 P 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 73/247 (30%)
Tryp_SPc 33..271 CDD:238113 74/247 (30%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 75/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.