DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG11664

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:223 Identity:58/223 - (26%)
Similarity:94/223 - (42%) Gaps:37/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FGSGHICGGALIAPRKVLTAAHCLYNNQRKR---FRRASEFVVVLGTLNRFEHRNGTIVSQVSSM 120
            :|...:..|:|.:.|.|||.|||...|.:..   .|....::.       :|.|.    .||:.:
  Fly    41 YGPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIA-------WEFRG----KQVAGL 94

  Fly   121 AYMHTFSPDSMRDDVGILFLRTGLPMSPGGGVH------LTVAPIQLAGQITPPGKLCQVAGWGR 179
            .....|||.::|:|:.:|.::..:..|     |      |...|:.......||.:|   |||..
  Fly    95 LRHPKFSPLTLRNDIAVLRVKAAISHS-----HMINYIGLCSRPLTPLNMFAPPQEL---AGWNL 151

  Fly   180 TEQSSLSNILLTANVSTIRHQTCRMIYR--SGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLV 242
            ..   ::..|.:.:|.....:.||..:.  ||   |::||.... |...|.||||.||:..|.:.
  Fly   152 MH---IAQPLKSMSVQVEPEKNCRQWFPQISG---GVICASATM-GEGLCYGDSGDPLISGGEVC 209

  Fly   243 GVVSWGYGCAEPGLPGVYVDVEYYRQWI 270
            |:......|.:...|.::.||.|:|.:|
  Fly   210 GLAIAFRKCGDKRYPALFTDVHYHRAFI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 57/221 (26%)
Tryp_SPc 33..271 CDD:238113 58/223 (26%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 58/223 (26%)
Tryp_SPc 38..237 CDD:214473 57/221 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.