DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Klk12

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:268 Identity:82/268 - (30%)
Similarity:121/268 - (45%) Gaps:48/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLACAAADLQENQQSRIINGSVAKADETRHLVSI---RLLRHDNNFGSGHICGGALIAPRKVLTA 78
            ||.|... |.:..:.:|.||.....:.....|.:   :.||          |||.|:..:.||||
  Rat     7 LLLCVVG-LSQADREKIYNGVECVKNSQPWQVGLFHGKYLR----------CGGVLVDRKWVLTA 60

  Fly    79 AHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFS---PD----SMRDDVG 136
            |||           :.:::|.||     ||....:  .::....:.|||   |.    ....:..
  Rat    61 AHC-----------SGKYMVRLG-----EHSLSKL--DLTEQLRLTTFSITHPSYHGAYQNHEHD 107

  Fly   137 ILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQ--SSLSNILLTANVSTIRH 199
            :..||...|:|    :...|.|:.|.....|.|..|.::|||.|.:  ....:.|...::|.:.:
  Rat   108 LRLLRLNRPIS----LTYAVRPVALPSSCAPTGAKCHISGWGTTNKPWDPFPDRLQCLDLSIVSN 168

  Fly   200 QTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGY--GCAEPGLPGVYVD 262
            :|||.::...:...|:|||. :.|.|:||||||||||..|.|.|:||||.  .|.:.|:||||..
  Rat   169 ETCRAVFPGRVTENMLCAGG-EAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTK 232

  Fly   263 VEYYRQWI 270
            |..|..||
  Rat   233 VCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 76/251 (30%)
Tryp_SPc 33..271 CDD:238113 78/252 (31%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 76/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.