DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and GZMA

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_006135.2 Gene:GZMA / 3001 HGNCID:4708 Length:262 Species:Homo sapiens


Alignment Length:256 Identity:88/256 - (34%)
Similarity:125/256 - (48%) Gaps:32/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKR 89
            :.|:...:||.|:........::|.:.|.|..       ||.|||||...|||||||   |..||
Human    21 IPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKT-------ICAGALIAKDWVLTAAHC---NLNKR 75

  Fly    90 FRRASEFVVVLG--TLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPMSPGGGV 152
            .:      |:||  ::.| |.....|:.......| ..:.|.:...|:.:|.|.....::.    
Human    76 SQ------VILGAHSITR-EEPTKQIMLVKKEFPY-PCYDPATREGDLKLLQLMEKAKINK---- 128

  Fly   153 HLTVAPIQLAGQITPPGKLCQVAGWGRTEQS-SLSNILLTANVSTIRHQTC--RMIYRSGLLPG- 213
            ::|:..:...|....||.:|||||||||..| |.|:.|...|::.|..:.|  |..|....:.| 
Human   129 YVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGM 193

  Fly   214 -MMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGY--GCAEPGLPGVYVDV-EYYRQWI 270
             |:|||.|:||.|||.||||.||:.||...||.|:|.  .|.:|..||||:.: :.:..||
Human   194 NMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 85/247 (34%)
Tryp_SPc 33..271 CDD:238113 87/248 (35%)
GZMANP_006135.2 Tryp_SPc 29..254 CDD:238113 85/246 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.