DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Elane

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:266 Identity:77/266 - (28%)
Similarity:108/266 - (40%) Gaps:44/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILFWFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVL 76
            :|...||.|.|.      .|.|:.|..|:......:||::.       ..||.||..|||...|:
  Rat    18 MLLALLLVCPAL------ASEIVGGRPAQPHAWPFMVSLQR-------RGGHFCGATLIARNFVM 69

  Fly    77 TAAHCLYNNQRKRFRRASEFVVVLGT--LNRFEHRNGTIVSQVSSM--AYMHTFSPDSMRDDVGI 137
            :||||:..      |......||||.  |.|.|.     ..|:.|:  .:.:.|.|..:.:|:.|
  Rat    70 SAAHCVNG------RNFQSVQVVLGAHDLRRREP-----TRQIFSVQRIFENGFDPSRLLNDIVI 123

  Fly   138 LFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRT-EQSSLSNILLTANVSTIRHQT 201
            :.|.....::....|....|..|..|..||    |...||||. ....|.::|...||:.:.:..
  Rat   124 IQLNGSATINANVQVAELPAQGQGVGNRTP----CVAMGWGRLGTNRPLPSVLQELNVTVVTNLC 184

  Fly   202 CRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSW--GYGCAEPGLPGVYVDVE 264
            .|.:....|:|      |.|.|.  |.||||||||....:.|:.|:  | ||.....|..:..|.
  Rat   185 RRRVNVCTLVP------RRQAGI--CFGDSGGPLVCNNLVQGIDSFIRG-GCGSGFYPDAFAPVA 240

  Fly   265 YYRQWI 270
            .:..||
  Rat   241 EFADWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 69/244 (28%)
Tryp_SPc 33..271 CDD:238113 71/245 (29%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 69/244 (28%)
Tryp_SPc 33..249 CDD:238113 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.