DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Klk11

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:259 Identity:86/259 - (33%)
Similarity:119/259 - (45%) Gaps:52/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QSRIING----------SVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYN 84
            ::|||.|          .||...:||.|                 ||..||||:.:||||||   
  Rat    48 ETRIIKGYECRPHSQPWQVALFQKTRLL-----------------CGATLIAPKWLLTAAHC--- 92

  Fly    85 NQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSM-----RDDVGILFLRTGL 144
                   |...:|::||..| .|..:|....::::.::.|....:|:     |:|:.:      :
  Rat    93 -------RKPHYVILLGEHN-LEKTDGCEQRRMATESFPHPGFNNSLPNKDHRNDIML------V 143

  Fly   145 PMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTE--QSSLSNILLTANVSTIRHQTCRMIYR 207
            .||....:...|.|:.|:......|..|.::|||.|.  |..|.:.|..||||.|.|:.|...|.
  Rat   144 KMSSPAFITRAVRPLTLSSLCVTAGTSCLISGWGTTSSPQLRLPHSLRCANVSIIGHKECERAYP 208

  Fly   208 SGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYG-CAEPGLPGVYVDVEYYRQWI 270
            ..:...|:||...:.|.||||||||||||..|.|.|::|||.. ||....||||..|..|..||
  Rat   209 GNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKYFDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 84/255 (33%)
Tryp_SPc 33..271 CDD:238113 85/256 (33%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 84/255 (33%)
Tryp_SPc 51..275 CDD:238113 85/256 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.