DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Habp2

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001001505.2 Gene:Habp2 / 292126 RGDID:1302979 Length:558 Species:Rattus norvegicus


Alignment Length:270 Identity:92/270 - (34%)
Similarity:127/270 - (47%) Gaps:35/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ACAAADLQENQQSRIINGSVAKADETRHLVSIRL-LRHDNNFGSGHICGGALIAPRKVLTAAHCL 82
            :|...::.|:...||..|..:.|.:....||::. |....:...||.|||:||.|..|||||||.
  Rat   298 SCGKTEMTEHAVKRIYGGFKSTAGKHPWQVSLQTSLPLTTSMPQGHFCGGSLIHPCWVLTAAHCT 362

  Fly    83 YNNQRKRFRRASEFVVVLG--TLNRFEHRNGTI-VSQVSSMAYMHTFSPDSM-RDDVGILFLRTG 143
             :...|..:      ||||  .|.:.|....|. |.::  :.|......|.: .:|:.:|.|:  
  Rat   363 -DMSTKHLK------VVLGDQDLKKTESHEQTFRVEKI--LKYSQYNERDEIPHNDIALLKLK-- 416

  Fly   144 LPMSPGGGVHLT-----VAPIQLAGQITPPGKLCQVAGWGRTEQSSLSNILLTANVSTIRHQTC- 202
                |.|| |..     |..:.|.....|.|..|.::|||.||....|..||.|.|..|.:..| 
  Rat   417 ----PVGG-HCALESKYVKTVCLPSDPFPSGTECHISGWGVTETGEGSRQLLDAKVKLIANALCN 476

  Fly   203 -RMIYRSGLLPGMMCAGRLQ-GGTDSCQGDSGGPLVHEG----RLVGVVSWGYGCAEPGLPGVYV 261
             |.:|...:...|:|||.|| .|:|:|||||||||..|.    .:.|:||||..|.:.  ||||.
  Rat   477 SRQLYDHTIDDSMICAGNLQKPGSDTCQGDSGGPLTCEKDGTYYVYGIVSWGQECGKK--PGVYT 539

  Fly   262 DVEYYRQWIE 271
            .|..:..||:
  Rat   540 QVTKFLNWIK 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 88/254 (35%)
Tryp_SPc 33..271 CDD:238113 88/254 (35%)
Habp2NP_001001505.2 EGF_CA 71..107 CDD:238011
KR 191..275 CDD:238056
Tryp_SPc 312..551 CDD:238113 89/256 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336782
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.