DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Prss38

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:229 Identity:73/229 - (31%)
Similarity:107/229 - (46%) Gaps:34/229 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLN---RFEHRNGTIVSQVSS 119
            ::...|:|||:::....|||||||.     .|.:|...|.:.:|..|   ..:|.....::||..
  Rat   132 HYAGFHVCGGSILNAYWVLTAAHCF-----AREKRLQTFDMYVGITNLEVANKHTQWFEINQVII 191

  Fly   120 MAYMHTFSPDSMRDDVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKL------CQVAGWG 178
            ......|.|  :..||.::..::.:..|.      .|.||.|     |...|      |...|||
  Rat   192 HPTFEMFHP--VGGDVALVQSKSAIVFSD------YVLPICL-----PSSNLNLSDLSCWTTGWG 243

  Fly   179 R-TEQSSLSNILLTANVSTIRHQTCRMIY--RSGLLPGMMCAGRLQGGTDSCQGDSGGPLV---- 236
            . :.|......||.|.:..|....|:::|  .|.|||.|:|||.::...:.|:||||.|||    
  Rat   244 MVSPQGETGKDLLEAQLPLIPKFQCQLLYGLTSYLLPEMLCAGDIKNMKNVCEGDSGSPLVCKVN 308

  Fly   237 HEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQWI 270
            .....:|:||||.|||:|..|||:.:|.|:..||
  Rat   309 QTWLQIGIVSWGRGCAQPLYPGVFANVSYFLNWI 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 71/227 (31%)
Tryp_SPc 33..271 CDD:238113 73/229 (32%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 73/229 (32%)
Tryp_SPc 116..342 CDD:214473 71/227 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.