DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Prss34

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:300 Identity:95/300 - (31%)
Similarity:126/300 - (42%) Gaps:67/300 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LFWFL---LACAAADLQENQQS-----RIINGSVAKADETRHLVSIR-----LLRHDNNFGSGHI 64
            :.|||   |.|..:.:.....|     .|:.|....|......||:|     |.:.:      ||
  Rat     5 MLWFLFLTLPCLGSTMPLTPDSGQELVGIVGGCPVSASRFPWQVSLRFYNMKLSKWE------HI 63

  Fly    65 CGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFS-- 127
            |||:||.|:.|||||||:...:.:    ||.|.|.:|.|..:|:..   :.:|:.:.....||  
  Rat    64 CGGSLIHPQWVLTAAHCVELKEME----ASCFRVQVGQLRLYENDQ---LMKVAKIIRHPKFSEK 121

  Fly   128 ---PDSMRDDVGILFLRTGLPMSPGGGVHLTVAPIQL--AGQITPPGKLCQVAGWGRTE------ 181
               |...  |:.:|.|.:.:.:|.      .|.|:.|  |.|.....|...|||||..|      
  Rat   122 LSAPGGA--DIALLKLDSTVVLSE------RVHPVSLPAASQRISSKKTWWVAGWGVIEGHRPLP 178

  Fly   182 -QSSLSNILLTANVSTIRHQTCRMIYRSG---------LLPGMMCAGRLQGGTDSCQGDSGGPLV 236
             ...|..:.    |..:.:..|...||:.         :...|:|||  ..|.||||.|||||||
  Rat   179 PPCHLREVA----VPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLCAG--MEGRDSCQADSGGPLV 237

  Fly   237 HEGRL----VGVVSWGYGCAEPGLPGVYVDVEYYRQWIEG 272
            .....    |||||||.||..|..||||..|..|..||.|
  Rat   238 CRWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYLSWIHG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 86/269 (32%)
Tryp_SPc 33..271 CDD:238113 87/269 (32%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 87/269 (32%)
Tryp_SPc 33..275 CDD:214473 86/268 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.