DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG33225

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:264 Identity:76/264 - (28%)
Similarity:123/264 - (46%) Gaps:55/264 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRASEF 96
            |::.|:  .||...:...:.:|..:|.|     |.|:||....|||:|.||.:..::        
  Fly    56 RVVGGN--DADRFANPWMVMVLGENNVF-----CSGSLITRLFVLTSASCLLSLPKQ-------- 105

  Fly    97 VVVLGTLNR-FEHRNGTIVSQVSSM--AYMH-TFSPDSMRD-DVGILFLRTGLPMSPGGGVHLTV 156
             |:||..:| ....:.|.:.||..:  ..:| .|..::::. |:.:|.|...:.:|.      .|
  Fly   106 -VILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISD------YV 163

  Fly   157 APIQLA--GQITPPGKLCQ---VAGWGRTEQSSLSNILLTANVSTIRHQTCRMIYRSGLLPGMMC 216
            .||.|:  .|:   |:..|   ..|||.||.:..|.||.|..:|.|..:.|:...|..:....:|
  Fly   164 RPICLSVDRQV---GRSVQHFTATGWGTTEWNEPSTILQTVTLSKINRKYCKGRLRQNIDASQLC 225

  Fly   217 AGRLQGGTDSCQGDSGGPLV------HEGR--------LVGVVSWG-YGCAEPGLPGVYVDVEYY 266
            .|..:  .|:|.||:||||.      .:|:        |:|:||:| ..|:  |: |||.:||:|
  Fly   226 VGGPR--KDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCS--GI-GVYTNVEHY 285

  Fly   267 RQWI 270
            ..||
  Fly   286 MDWI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 74/262 (28%)
Tryp_SPc 33..271 CDD:238113 75/263 (29%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 74/262 (28%)
Tryp_SPc 57..292 CDD:238113 75/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442137
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.