DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG33226

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:308 Identity:84/308 - (27%)
Similarity:117/308 - (37%) Gaps:85/308 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YILFWFLLA---------------CAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFG 60
            ::|..|:||               |....:...:|  |:.|.  .||...|...:::|:.     
  Fly    12 WLLVCFILALRSYESLGQDLLDPNCVQTPVGVREQ--ILGGH--NADIKLHPWMVQILQR----- 67

  Fly    61 SGHICGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHT 125
            ..|.|||:||:...|||||||   :.|.|.:            .||...:|.....:.|..|...
  Fly    68 GYHFCGGSLISSLFVLTAAHC---HSRYRLK------------VRFGRYSGITPRYLCSSQYCSP 117

  Fly   126 FSPDSMRDDVGILFLRTGLPMSPGGGVH-------LTVAPIQLAGQITP--------PGKLCQ-- 173
            |.|:.   ||..:||.     |.....|       |...|::...|..|        ..||.|  
  Fly   118 FGPEI---DVKRIFLH-----SSYRDYHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFL 174

  Fly   174 -------VAGWGRTEQSSLSNILLTANVSTIRHQTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDS 231
                   |.|||:||....|.||.|.::..:..:.|..|:...:....:|||..|..|  |.|||
  Fly   175 NYVAMFNVTGWGKTESQLTSTILQTTSLFHLDRKFCAQIFDRKIGWPHICAGHSQSST--CTGDS 237

  Fly   232 GGPL--------VHEGRLVGVVSWGY-GCAEPGLPGVYVDVEYYRQWI 270
            ||||        |....|.|::|:|. .|.|   ..|:.:|..|..||
  Fly   238 GGPLSAELTFSGVKRTVLFGIISYGAPNCRE---VTVFTNVLRYSNWI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 76/270 (28%)
Tryp_SPc 33..271 CDD:238113 78/271 (29%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 78/271 (29%)
Tryp_SPc 47..282 CDD:214473 76/269 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442141
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.