DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Gzma

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_703198.1 Gene:Gzma / 266708 RGDID:628640 Length:261 Species:Rattus norvegicus


Alignment Length:263 Identity:80/263 - (30%)
Similarity:121/263 - (46%) Gaps:34/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAH 80
            |||.     :.|....|||.|.........::|.:: |:.|:      ||.|||||...||||||
  Rat    17 FLLL-----IPEGGCERIIGGDTVVPHSRPYMVLLK-LKPDS------ICAGALIAKNWVLTAAH 69

  Fly    81 CLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLP 145
            |:...:.:         |:||..:..:.....|:|...:..| ..|...:...|:.:|.|:....
  Rat    70 CIPGKKSE---------VILGAHSIKKEPEQQILSVKKAYPY-PCFDKHTHEGDLQLLRLKKKAT 124

  Fly   146 MSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGR-TEQSSLSNILLTANVSTIRHQTCRMIYRSG 209
            ::.    ::.:..:...|....||..|.|||||| ..:|..|:.|...|::.|..:.|.......
  Rat   125 LNK----NVAILHLPKKGDDVKPGTRCHVAGWGRFHNKSPPSDTLREVNITVIDRKICNDEKHYN 185

  Fly   210 LLP----GMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGY--GCAEPGLPGVYVDV-EYYR 267
            ..|    .|:|||.|:||.|||.|||||||:.||...|:.::|.  .|.:|..||:|..: :.:.
  Rat   186 FNPVIGLNMICAGNLRGGKDSCYGDSGGPLLCEGIFRGITAFGLEGRCGDPKGPGIYTLLSDKHL 250

  Fly   268 QWI 270
            .||
  Rat   251 DWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 74/245 (30%)
Tryp_SPc 33..271 CDD:238113 75/246 (30%)
GzmaNP_703198.1 Tryp_SPc 28..253 CDD:214473 74/245 (30%)
Tryp_SPc 29..256 CDD:238113 75/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336784
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.