DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Prss45

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:269 Identity:88/269 - (32%)
Similarity:119/269 - (44%) Gaps:64/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 HICGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLG--TLNRFEHRNG---TIVSQVSSMAY 122
            |:||||||....|::||||:..|:        |:.|:||  ||    |.||   |:...|..: .
Mouse    73 HVCGGALIDRSWVVSAAHCIQGNK--------EYSVMLGSSTL----HPNGSSWTLKIPVGDI-I 124

  Fly   123 MHT--FSPDSMRDDVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPP-------GKLCQVAGWG 178
            :|.  :..:.:|.|:.:|.|.|.:..:.      .|.||.|     |.       |..|.|.|||
Mouse   125 IHPKYWGRNFIRSDIALLCLETPVTFNK------YVQPICL-----PEHNFNFKVGTKCWVTGWG 178

  Fly   179 RTEQSSLSNI-----LLTANVSTIRHQTCRMIY-RSGLLP--------GMMCAGRLQGGTDSCQG 229
            :.:|.|.:.:     |..|.|..|.::.|..|: :..|.|        .|:|....  |.|.|.|
Mouse   179 QVKQHSSAQLTPAPELWEAEVFIIDNKNCDSIFHKKTLYPQVVPLIRKNMICTTNY--GEDLCYG 241

  Fly   230 DSGGPLVHE--GR--LVGVVSWGYGCAE-PGLPGVYVDVEYYRQWIEGR--SGAPHSRLATGLFL 287
            |.||||..|  ||  |.||.||...||. |.| .||..:..|..||:.:  .||......|.  .
Mouse   242 DPGGPLACEIDGRWILAGVFSWEKACATVPNL-SVYTRITKYTIWIKDQVSHGAQLGPCRTS--W 303

  Fly   288 LLLLPLLMR 296
            |||||.|::
Mouse   304 LLLLPWLLQ 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 77/239 (32%)
Tryp_SPc 33..271 CDD:238113 78/240 (33%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 79/242 (33%)
Tryp_SPc 59..286 CDD:214473 77/239 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.