DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and mst1

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_694512.1 Gene:mst1 / 259260 ZFINID:ZDB-GENE-020806-3 Length:709 Species:Danio rerio


Alignment Length:271 Identity:61/271 - (22%)
Similarity:105/271 - (38%) Gaps:55/271 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 CAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYN 84
            |...:.:...:.||:.|:...:..|   ||:|    |..  ..|.|||:|::...|::...|.  
Zfish   469 CGKREDRLRSRLRIVGGTPGNSPWT---VSLR----DRK--GNHFCGGSLVSSEWVISTKQCF-- 522

  Fly    85 NQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPMSPG 149
              ...:...:.:..::|||.| :.:.|               .||..|..:      |.:...|.
Zfish   523 --SSCYVDLTGYTAMMGTLFR-DPKEG---------------EPDLQRISL------TKIVCGPS 563

  Fly   150 GGVHLTVAPIQLAGQ---------------ITPPGKLCQVAGWGRTEQSSLSNILLTANVSTIRH 199
            .. ||.:..::...|               |.|.|.:|::||||.|:......:|..|.:..:.:
Zfish   564 ES-HLVMLQLETPAQFNERVSQICLPPERYIVPDGTICEIAGWGETKGKGDETVLNVAQMPVLSN 627

  Fly   200 QTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGR----LVGVVSWGYGCAEPGLPGVY 260
            :.|...::..:....||....|.|..:|:.|.||||..:..    |.||:.....|...|.|.::
Zfish   628 KDCNQYFKGRVRENEMCTMAFQAGVGACERDYGGPLACQNSDCWVLEGVIIPMRRCGHAGQPNIF 692

  Fly   261 VDVEYYRQWIE 271
            :.|..|..||:
Zfish   693 IRVSVYVDWIK 703

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 58/256 (23%)
Tryp_SPc 33..271 CDD:238113 58/256 (23%)
mst1NP_694512.1 PAN_AP_HGF 24..105 CDD:238532
KR 109..187 CDD:238056
KR 192..271 CDD:214527
KR 284..365 CDD:214527
KR 370..451 CDD:238056
Tryp_SPc 481..702 CDD:214473 58/256 (23%)
Tryp_SPc 482..705 CDD:238113 59/258 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575879
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.