DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG30289

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:224 Identity:71/224 - (31%)
Similarity:104/224 - (46%) Gaps:35/224 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLG---TLNRFEH--RNGTIVS--QVS-SMA 121
            |||:|||.:.|||||||:         ...:..|.||   ||:...:  .|..|..  .:| .|.
  Fly    65 CGGSLIARQFVLTAAHCV---------SFEDLYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMK 120

  Fly   122 YMH-TFSPDSMRDDVGILFLRTGLPMSPGGGVHLTVAPI-QLAGQITPPGKLCQVAGWGRTEQSS 184
            .:| .::..::::|:.:|.:...:..|.      .|.|| .|.|:......:..|.|||.||...
  Fly   121 IVHENYNGITLQNDIALLRMSEAVEYSD------YVRPICLLVGEQMQSIPMFTVTGWGETEYGQ 179

  Fly   185 LSNILLTANVSTIRHQTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPL---VHEG-RLV--- 242
            .|.|||.|.:..:....|.:.:........:|||.....|  |:|||||||   .|.| ||:   
  Fly   180 FSRILLNATLYNMDISYCNIKFNKQADRSQICAGSHTSNT--CKGDSGGPLSSKFHYGNRLLSFQ 242

  Fly   243 -GVVSWGYGCAEPGLPGVYVDVEYYRQWI 270
             |:||:|.......:.|||.:|.|:|:||
  Fly   243 YGLVSYGSERCAANVAGVYTNVSYHREWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 69/222 (31%)
Tryp_SPc 33..271 CDD:238113 71/224 (32%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 69/222 (31%)
Tryp_SPc 42..271 CDD:238113 69/222 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.